Lineage for d5wlgj2 (5wlg J:115-243)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (919 PDB entries)
  8. 2298412Domain d5wlgj2: 5wlg J:115-243 [341713]
    Other proteins in same PDB: d5wlga1, d5wlgb_, d5wlgd2, d5wlgf1, d5wlgf2, d5wlgg_, d5wlgi2
    automated match to d2vlme2
    complexed with cl, na

Details for d5wlgj2

PDB Entry: 5wlg (more details), 2.1 Å

PDB Description: crystal structure of h-2db with the gap501 peptide (sql)
PDB Compounds: (J:) T-cell receptor beta chain V region C5,Human nkt tcr beta chain chimera

SCOPe Domain Sequences for d5wlgj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wlgj2 b.1.1.0 (J:115-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d5wlgj2:

Click to download the PDB-style file with coordinates for d5wlgj2.
(The format of our PDB-style files is described here.)

Timeline for d5wlgj2:

  • d5wlgj2 appears in periodic updates to SCOPe 2.06 starting on 2017-11-17