SCOPe 2.08: Domain d5wlgj1: 5wlg J:3-114

Lineage for d5wlgj1 (5wlg J:3-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5wlgj1: 5wlg J:3-114 [341712]
   Other proteins in same PDB: d5wlga1, d5wlgb_, d5wlgd2, d5wlgf1, d5wlgf2, d5wlgg_, d5wlgi2
   automated match to d2axha1
   complexed with cl, na

Details for d5wlgj1

PDB Entry: 5wlg, 2.1 Å

PDB Description: crystal structure of h-2db with the gap501 peptide (sql)

PDB Compounds: (J:) T-cell receptor beta chain V region C5,Human nkt tcr beta chain

SCOPe Domain Sequences for d5wlgj1:

Sequence; same for both SEQRES and ATOM records:

>d5wlgj1 b.1.1.0 (J:3-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd
gykasrpsqenfslilelaslsqtavyfcassdwgdtgqlyfgegskltvle

Timeline for d5wlgj1:

• d5wlgj1 first appeared in SCOPe 2.06
  
• d5wlgj1 appears in SCOPe 2.07