Lineage for d2pdab4 (2pda B:416-668)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399303Fold c.64: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53322] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 231456; strand 3 is antiparallel to the rest
  4. 399304Superfamily c.64.1: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53323] (1 family) (S)
  5. 399305Family c.64.1.1: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53324] (1 protein)
  6. 399306Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53325] (1 species)
    also includes linker domain IV
  7. 399307Species Desulfovibrio africanus [TaxId:873] [53326] (3 PDB entries)
  8. 399313Domain d2pdab4: 2pda B:416-668 [34160]
    Other proteins in same PDB: d2pdaa1, d2pdaa2, d2pdaa3, d2pdaa5, d2pdab1, d2pdab2, d2pdab3, d2pdab5
    complexed with ca, fs4, mg, pyr, tpp

Details for d2pdab4

PDB Entry: 2pda (more details), 3 Å

PDB Description: crystal structure of the complex between pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus and pyruvate.

SCOP Domain Sequences for d2pdab4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pdab4 c.64.1.1 (B:416-668) Pyruvate-ferredoxin oxidoreductase, PFOR, domain III {Desulfovibrio africanus}
gtiqcqfwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpi
qstylvnradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtia
nkklkfynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkg
ekivkmntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklp
vsafeadgrfplg

SCOP Domain Coordinates for d2pdab4:

Click to download the PDB-style file with coordinates for d2pdab4.
(The format of our PDB-style files is described here.)

Timeline for d2pdab4: