![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) |
![]() | Protein Integrin alpha2-beta1 [53313] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53314] (3 PDB entries) Uniprot P17301 172-364 |
![]() | Domain d1aoxa_: 1aox A: [34151] complexed with mg |
PDB Entry: 1aox (more details), 2.1 Å
SCOPe Domain Sequences for d1aoxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aoxa_ c.62.1.1 (A:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} scpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnln tyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgesh dgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsde aallekagtlgeqifsieggt
Timeline for d1aoxa_: