Lineage for d1aoxa_ (1aox A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378146Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1378147Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1378148Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 1378196Protein Integrin alpha2-beta1 [53313] (1 species)
  7. 1378197Species Human (Homo sapiens) [TaxId:9606] [53314] (3 PDB entries)
    Uniprot P17301 172-364
  8. 1378199Domain d1aoxa_: 1aox A: [34151]
    complexed with mg

Details for d1aoxa_

PDB Entry: 1aox (more details), 2.1 Å

PDB Description: i domain from integrin alpha2-beta1
PDB Compounds: (A:) integrin alpha 2 beta

SCOPe Domain Sequences for d1aoxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoxa_ c.62.1.1 (A:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]}
scpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnln
tyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgesh
dgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsde
aallekagtlgeqifsieggt

SCOPe Domain Coordinates for d1aoxa_:

Click to download the PDB-style file with coordinates for d1aoxa_.
(The format of our PDB-style files is described here.)

Timeline for d1aoxa_: