SCOPe 2.08: Domain d1ao3b_: 1ao3 B:

Lineage for d1ao3b_ (1ao3 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein von Willebrand factor A3 domain, vWA3 [53304] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53305] (3 PDB entries)

8. Domain d1ao3b_: 1ao3 B: [34135]

Details for d1ao3b_

PDB Entry: 1ao3, 2.2 Å

PDB Description: a3 domain of von willebrand factor

PDB Compounds: (B:) von willebrand factor

SCOPe Domain Sequences for d1ao3b_:

Sequence; same for both SEQRES and ATOM records:

>d1ao3b_ c.62.1.1 (B:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]}
csqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvpw
nvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvsv
dsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlgn
sflhklc

Timeline for d1ao3b_:

• d1ao3b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ao3b_ appears in SCOPe 2.07