Lineage for d1atzb_ (1atz B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.62: vWA-like [53299] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the restSuperfamily c.62.1: vWA-like [53300] (6 families) 
Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) 
Protein von Willebrand factor A3 domain, vWA3 [53304] (1 species) Species Human (Homo sapiens) [TaxId:9606] [53305] (3 PDB entries) 
Domain d1atzb_: 1atz B: [34133]
Details for d1atzb_
PDB Entry: 1atz (more details), 1.8 Å
PDB Description: human von willebrand factor a3 domain
PDB Compounds: (B:) von willebrand factorSCOPe Domain Sequences for d1atzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1atzb_ c.62.1.1 (B:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]}
dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp
wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs
vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg
nsflhklcs
SCOPe Domain Coordinates for d1atzb_:
Click to download the PDB-style file with coordinates for d1atzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1atzb_:
- d1atzb_ first appeared (with stable ids) in SCOP 1.55
- d1atzb_ appears in SCOPe 2.07
View in 3D
