Lineage for d5oria3 (5ori A:388-583)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343304Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2343305Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2343749Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2343750Protein automated matches [254493] (6 species)
    not a true protein
  7. 2343782Species Goat (Capra hircus) [TaxId:9925] [341296] (4 PDB entries)
  8. 2343791Domain d5oria3: 5ori A:388-583 [341318]
    automated match to d1n5ua3

Details for d5oria3

PDB Entry: 5ori (more details), 1.94 Å

PDB Description: structure of caprine serum albumin in orthorhombic crystal system
PDB Compounds: (A:) Albumin

SCOPe Domain Sequences for d5oria3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oria3 a.126.1.0 (A:388-583) automated matches {Goat (Capra hircus) [TaxId: 9925]}
kkncelfekhgeygfqnalivrytrkapqvstptlveisrslgkvgtkccakpesermpc
tedylslilnrlcvlhektpvsekvtkccteslvnrrpcfsdltldetyvpkpfdgesft
fhadictlpdtekqikkqtalvellkhkpkatdeqlktvmenfvafvdkccaaddkegcf
llegpklvastqaala

SCOPe Domain Coordinates for d5oria3:

Click to download the PDB-style file with coordinates for d5oria3.
(The format of our PDB-style files is described here.)

Timeline for d5oria3: