SCOPe 2.07: Domain d5wkia2: 5wki A:184-277

Lineage for d5wkia2 (5wki A:184-277)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d5wkia2: 5wki A:184-277 [341122]
   Other proteins in same PDB: d5wkia1, d5wkib_, d5wkid2
   automated match to d3l9ra2
   complexed with act, cl, cuy, d3d, edo, fuc, na, nag

Details for d5wkia2

PDB Entry: 5wki, 2.75 Å

PDB Description: crystal structure of pg90 tcr-cd1b-pg complex

PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d5wkia2:

Sequence, based on SEQRES records:

>d5wkia2 b.1.1.0 (A:184-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilyw

Sequence, based on observed residues (ATOM records):

>d5wkia2 b.1.1.0 (A:184-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpeawlssgpsgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtwylr
atldvadgeaaglscrvkhsslegqdiilyw

Timeline for d5wkia2:

• d5wkia2 first appeared in SCOPe 2.06
  
• d5wkia2 appears in the current release, SCOPe 2.08