SCOPe 2.07: Domain d5pgye_: 5pgy E:

Lineage for d5pgye_ (5pgy E:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein automated matches [190085] (58 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186828] (33 PDB entries)

8. Domain d5pgye_: 5pgy E: [340957]
   Other proteins in same PDB: d5pgyb2, d5pgyd2
   automated match to d3dwfc1
   complexed with 8kg, nap; mutant

Details for d5pgye_

PDB Entry: 5pgy, 2.07 Å

PDB Description: crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with 2-[(5r,7s)-6-hydroxy-2-phenyladamantan-2-yl]-1-(3- hydroxyazetidin-1-yl)ethan-1-one (bms-816336)

PDB Compounds: (E:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d5pgye_:

Sequence; same for both SEQRES and ATOM records:

>d5pgye_ c.2.1.2 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaa
sahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnf
lsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvs
rvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydssrwt
tllirnpcrkileelystsynmdr

Timeline for d5pgye_:

• d5pgye_ first appeared in SCOPe 2.06
  
• d5pgye_ appears in the current release, SCOPe 2.08