![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53284] (9 PDB entries) |
![]() | Domain d1hmpa_: 1hmp A: [34075] complexed with 5gp |
PDB Entry: 1hmp (more details), 2.5 Å
SCOPe Domain Sequences for d1hmpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hmpa_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip dkfvvgyaldyneyfrdlnhvcvisetgkakyka
Timeline for d1hmpa_: