Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (10 species) not a true protein |
Species Sus barbatus [TaxId:41807] [278811] (7 PDB entries) |
Domain d5xi5c1: 5xi5 C:1-245 [340403] Other proteins in same PDB: d5xi5a2, d5xi5b2, d5xi5c2, d5xi5d2, d5xi5e_, d5xi5f1, d5xi5f2, d5xi5f3 automated match to d4ihja1 complexed with acp, ca, gdp, gtp, mes, mg, pn6 |
PDB Entry: 5xi5 (more details), 2.81 Å
SCOPe Domain Sequences for d5xi5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xi5c1 c.32.1.1 (C:1-245) automated matches {Sus barbatus [TaxId: 41807]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita slrfd
Timeline for d5xi5c1: