Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) |
Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins) |
Protein automated matches [190187] (2 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [340391] (1 PDB entry) |
Domain d6bb9a1: 6bb9 A:1-269 [340399] Other proteins in same PDB: d6bb9a2 automated match to d1i2ka_ complexed with cl, edo, mes, so4 |
PDB Entry: 6bb9 (more details), 2.28 Å
SCOPe Domain Sequences for d6bb9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bb9a1 e.17.1.1 (A:1-269) automated matches {Salmonella typhimurium [TaxId: 90371]} mflinghaqdqlavsdratqfgdgsfttarivdgnichleahlqrlqvaceklriafshw stlrqemtmlatghdsgvlkviisrgsggrgysamncqaatrilsvsaypayysqwrkqg itltlspiplgrnpylaglkhlnrleqvlirshleqtdadealvldsegwvteccaanlf wrtgdivftprldqagvngimrqfclrqlaqspfqvlevqareeavrqadeiiicnalmp iipirayhgtsyssrtlfqflapfcehpn
Timeline for d6bb9a1: