Lineage for d5xhca1 (5xhc A:1-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2472363Species Sus barbatus [TaxId:41807] [278811] (7 PDB entries)
  8. 2472378Domain d5xhca1: 5xhc A:1-245 [340397]
    Other proteins in same PDB: d5xhca2, d5xhcb2, d5xhcc2, d5xhcd2, d5xhce_, d5xhcf1, d5xhcf2, d5xhcf3
    automated match to d4ihja1
    complexed with 87u, acp, ca, gdp, gtp, mes, mg

Details for d5xhca1

PDB Entry: 5xhc (more details), 2.75 Å

PDB Description: crystal structure of t2r-ttl-po10 complex
PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d5xhca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xhca1 c.32.1.1 (A:1-245) automated matches {Sus barbatus [TaxId: 41807]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5xhca1:

Click to download the PDB-style file with coordinates for d5xhca1.
(The format of our PDB-style files is described here.)

Timeline for d5xhca1: