SCOPe 2.03: Domain d1qk3b_: 1qk3 B:

Lineage for d1qk3b_ (1qk3 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine-guanine-xanthine PRTase [53275] (3 species)

7. Species Toxoplasma gondii [TaxId:5811] [53277] (5 PDB entries)

8. Domain d1qk3b_: 1qk3 B: [34032]
   complexed with 5gp

Details for d1qk3b_

PDB Entry: 1qk3, 1.65 Å

PDB Description: toxoplasma gondii hypoxanthine-guanine phosphoribosyltransferase gmp complex

PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1qk3b_:

Sequence; same for both SEQRES and ATOM records:

>d1qk3b_ c.61.1.1 (B:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]}
gshmaskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrve
klaydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlks
yqndnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlve
krtdrsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkf

Timeline for d1qk3b_:

• d1qk3b_ first appeared (with stable ids) in SCOP 1.55
  
• d1qk3b_ appears in SCOPe 2.02
  
• d1qk3b_ appears in SCOPe 2.04
  
• d1qk3b_ appears in the current release, SCOPe 2.08, called d1qk3b1