![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Hypoxanthine-guanine-xanthine PRTase [53275] (3 species) |
![]() | Species Toxoplasma gondii [TaxId:5811] [53277] (5 PDB entries) |
![]() | Domain d1qk3b_: 1qk3 B: [34032] complexed with 5gp |
PDB Entry: 1qk3 (more details), 1.65 Å
SCOPe Domain Sequences for d1qk3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qk3b_ c.61.1.1 (B:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} gshmaskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrve klaydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlks yqndnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlve krtdrsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkf
Timeline for d1qk3b_: