Lineage for d5u6gk_ (5u6g K:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414734Protein automated matches [190295] (7 species)
    not a true protein
  7. 2414754Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)
  8. 2414977Domain d5u6gk_: 5u6g K: [340307]
    automated match to d4zcbb_
    complexed with ret; mutant

Details for d5u6gk_

PDB Entry: 5u6g (more details), 2.6 Å

PDB Description: crystal structure of the holo domain-swapped dimer mutant q108k:k40d human cellular retinol binding protein ii bound with all trans retinal
PDB Compounds: (K:) Retinol-binding protein 2

SCOPe Domain Sequences for d5u6gk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u6gk_ b.60.1.2 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegymkaldidfatrkiavrltqtdvidqdgdnfktkttstfrny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk

SCOPe Domain Coordinates for d5u6gk_:

Click to download the PDB-style file with coordinates for d5u6gk_.
(The format of our PDB-style files is described here.)

Timeline for d5u6gk_: