SCOPe 2.07: Domain d5w6ya_: 5w6y A:

Lineage for d5w6ya_ (5w6y A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families)

5. Family a.130.1.0: automated matches [237401] (1 protein)
   not a true family

6. Protein automated matches [237402] (7 species)
   not a true protein

7. Species Physcomitrella patens [TaxId:3218] [340155] (1 PDB entry)

8. Domain d5w6ya_: 5w6y A: [340158]
   automated match to d4csma_
   complexed with epe, trp

Details for d5w6ya_

PDB Entry: 5w6y, 2 Å

PDB Description: physcomitrella patens chorismate mutase

PDB Compounds: (A:) chorismate mutase

SCOPe Domain Sequences for d5w6ya_:

Sequence; same for both SEQRES and ATOM records:

>d5w6ya_ a.130.1.0 (A:) automated matches {Physcomitrella patens [TaxId: 3218]}
lanireslirqedtiiyallqraqfsfnaptydensfsipgfkgslvefmlketetlhak
vrryqapdehpffpedlsqpilpslpksrvlhpaaekininksiwsmylqdllpkltvpd
ddgnygsasvcdvlclqalskrihygkfvaeakfiedparfeghikaqdgdailreltfk
nvednvkrrvankaraygqevnehgkvdnarykidpdlagalyedwvmpltkqvqvayll
rrld

Timeline for d5w6ya_:

• d5w6ya_ first appeared in SCOPe 2.06
  
• d5w6ya_ appears in the current release, SCOPe 2.08