![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (91 species) not a true protein |
![]() | Species Toxoplasma gondii [TaxId:5811] [339857] (6 PDB entries) |
![]() | Domain d5tkpa_: 5tkp A: [339866] automated match to d3kx6a_ complexed with p6f |
PDB Entry: 5tkp (more details), 2.09 Å
SCOPe Domain Sequences for d5tkpa_:
Sequence, based on SEQRES records: (download)
>d5tkpa_ c.1.10.0 (A:) automated matches {Toxoplasma gondii [TaxId: 5811]} sgyglpisqevakelaenarkiaapgkgilaadestgtikkrfdsigventeanrafyrd llfstkglgqyisgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltdde katmgldglserckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicqa nrlvpivepeiltdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsdc pkpasheeiafytvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsfs ygralqasclkawkgvpenkakaqqvlmerarangeaqlgkygggaggalaasslfekry vy
>d5tkpa_ c.1.10.0 (A:) automated matches {Toxoplasma gondii [TaxId: 5811]} sgyglpisqevakelaenarkiaapgkgilaadestgtikkrfdsigventeanrafyrd llfstkglgqyisgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltdde katmgldglserckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicqa nrlvpivepeiltdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsdc pkpasheeiafytvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsfs ygralqasclkawkgvpenkakaqqvlmerarangeaqlgkygggayvy
Timeline for d5tkpa_: