Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Synaptic protein PSD-95 [50162] (2 species) Synonym: synapse associated protein 90, sap90 duplication: contains three PDZ domains |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [50163] (14 PDB entries) Uniprot P31016 62-154 |
Domain d5mz7c_: 5mz7 C: [339801] automated match to d3i4wa_ |
PDB Entry: 5mz7 (more details), 1.53 Å
SCOPe Domain Sequences for d5mz7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mz7c_ b.36.1.1 (C:) Synaptic protein PSD-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]} dipreprrivihrgstglgfniiggedgegifisfxlaggpadlsgelrkgdqilsvngv dlrnasheqaaialknagqtvtiiaqykpeeysrfea
Timeline for d5mz7c_: