Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries) |
Domain d5xlta2: 5xlt A:246-437 [339747] Other proteins in same PDB: d5xlta1, d5xltb1, d5xltc1, d5xltd1, d5xlte_, d5xltf1, d5xltf2, d5xltf3 automated match to d4i50a2 complexed with 89o, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5xlt (more details), 2.81 Å
SCOPe Domain Sequences for d5xlta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xlta2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgv
Timeline for d5xlta2: