SCOPe 2.07: Domain d5xd9a2: 5xd9 A:131-362

Lineage for d5xd9a2 (5xd9 A:131-362)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (78 species)
   not a true protein

7. Species Vibrio sp. [TaxId:1116375] [339695] (3 PDB entries)

8. Domain d5xd9a2: 5xd9 A:131-362 [339719]
   Other proteins in same PDB: d5xd9a1
   automated match to d2ovld2
   complexed with mg

Details for d5xd9a2

PDB Entry: 5xd9, 2.6 Å

PDB Description: crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase

PDB Compounds: (A:) 3,6-anhydro-alpha-L-galactonate cycloisomerase

SCOPe Domain Sequences for d5xd9a2:

Sequence; same for both SEQRES and ATOM records:

>d5xd9a2 c.1.11.0 (A:131-362) automated matches {Vibrio sp. [TaxId: 1116375]}
knntckaycggidlqfplekllnnicgylesgfnavkikigrenmqedidrikavrelig
pditfmidanysltveqaiklskaveqyditwfeeptlpddykgfaeiadntaiplamge
nlhtihefgyamdqaklgycqpdasncggitgwlkaadlitehnipvctngmqelhvslv
safdtgwlevhsfpideytkrplvvenfravasnepgigvefdwdkiaqyev

Timeline for d5xd9a2:

• d5xd9a2 first appeared in SCOPe 2.06
  
• d5xd9a2 appears in the current release, SCOPe 2.08