SCOPe 2.07: Domain d4uixc1: 4uix C:44-163

Lineage for d4uixc1 (4uix C:44-163)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d4uixc1: 4uix C:44-163 [339676]
   Other proteins in same PDB: d4uixa2, d4uixb2, d4uixc2
   automated match to d4hbwa_
   complexed with ca, edo, tvu

Details for d4uixc1

PDB Entry: 4uix, 1.58 Å

PDB Description: n-terminal bromodomain of human brd4 with 7-(3,4-dimethoxyphenyl)-n- (1,1-dioxo-1-thian-4-yl)-5-methyl-4-oxo-4h,5h-thieno-3,2-c-pyridine- 2- carboxamide

PDB Compounds: (C:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d4uixc1:

Sequence, based on SEQRES records:

>d4uixc1 a.29.2.0 (C:44-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nppppetsnpnkpkrqtnqlqyllrvvlktlwkhkfawpfqqpvdavklnlpdyykiikt
pmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine

Sequence, based on observed residues (ATOM records):

>d4uixc1 a.29.2.0 (C:44-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nppppetrqtnqlqyllrvvlktlwkhkfawpfqqpvdavklnlpdyykiiktpmdmgti
kkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine

Timeline for d4uixc1:

• d4uixc1 first appeared in SCOPe 2.06
  
• d4uixc1 appears in the current release, SCOPe 2.08