Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) |
Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) |
Protein HIV capsid protein, dimerisation domain [47359] (3 species) |
Species Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId:11698] [346174] (1 PDB entry) |
Domain d5teoa_: 5teo A: [339627] automated match to d2xt1a_ |
PDB Entry: 5teo (more details), 2.05 Å
SCOPe Domain Sequences for d5teoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5teoa_ a.28.3.1 (A:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]} tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp gatleemmtacq
Timeline for d5teoa_: