SCOPe 2.07: Domain d5o0wg1: 5o0w G:2-135

Lineage for d5o0wg1 (5o0w G:2-135)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (22 species)
not a true protein
Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)
Domain d5o0wg1: 5o0w G:2-135 [339585]
Other proteins in same PDB: d5o0wa_, d5o0wb_, d5o0wc_, d5o0wd_, d5o0we2, d5o0wf2, d5o0wg2, d5o0wh2
automated match to d4dkaa_
complexed with gol

Details for d5o0wg1

PDB Entry: 5o0w (more details), 2.57 Å

PDB Description: crystal structure of the complex between nb474 and trypanosoma congolense fructose-1,6-bisphosphate aldolase

PDB Compounds: (G:) Nb474

SCOPe Domain Sequences for d5o0wg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o0wg1 b.1.1.1 (G:2-135) automated matches {Vicugna pacos [TaxId: 30538]}
vqlqesggglvqpggslrlscaasetaltyyaigwfrqapgkeregvscisrinsgsgar
tdyadsvkgrftisrddakntvtlqmnslepedtaryycaldttdrydsangryyctiss
dtydywgqgtqvtv

SCOPe Domain Coordinates for d5o0wg1:

Click to download the PDB-style file with coordinates for d5o0wg1.
(The format of our PDB-style files is described here.)

Timeline for d5o0wg1: