SCOPe 2.07: Domain d5jcba1: 5jcb A:1-245

Lineage for d5jcba1 (5jcb A:1-245)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries)

8. Domain d5jcba1: 5jcb A:1-245 [339498]
   Other proteins in same PDB: d5jcba2, d5jcbb2, d5jcbc2, d5jcbd2, d5jcbe_, d5jcbf1, d5jcbf2
   automated match to d4ihja1
   complexed with acp, ca, gdp, gol, gtp, imd, mes, mg, na, nv4, peg

Details for d5jcba1

PDB Entry: 5jcb, 2.3 Å

PDB Description: microtubule depolymerizing agent podophyllotoxin derivative yjtsf1

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5jcba1:

Sequence; same for both SEQRES and ATOM records:

>d5jcba1 c.32.1.1 (A:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d5jcba1:

• d5jcba1 first appeared in SCOPe 2.06
  
• d5jcba1 appears in the current release, SCOPe 2.08