Lineage for d1efkb2 (1efk B:21-279)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) 
Family c.58.1.3: Mitochondrial NAD(P)-dependenent malic enzyme [53240] (1 protein) Protein Mitochondrial NAD(P)-dependenent malic enzyme [53241] (1 species) Species Human (Homo sapiens) [TaxId:9606] [53242] (4 PDB entries) 
Domain d1efkb2: 1efk B:21-279 [33948]
Other proteins in same PDB: d1efka1, d1efkb1, d1efkc1, d1efkd1
Details for d1efkb2
PDB Entry: 1efk (more details), 2.6 Å
PDB Description: structure of human malic enzyme in complex with ketomalonate
SCOP Domain Sequences for d1efkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efkb2 c.58.1.3 (B:21-279) Mitochondrial NAD(P)-dependenent malic enzyme {Human (Homo sapiens)}
ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
nafrflrkyrekyctfndd
SCOP Domain Coordinates for d1efkb2:
Click to download the PDB-style file with coordinates for d1efkb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1efkb2:
View in 3D
