SCOPe 2.07: Domain d6b1ea2: 6b1e A:509-766

Lineage for d6b1ea2 (6b1e A:509-766)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (94 PDB entries)

8. Domain d6b1ea2: 6b1e A:509-766 [339435]
   Other proteins in same PDB: d6b1ea1, d6b1eb1
   automated match to d1orva2
   complexed with lf7, na, nag

Details for d6b1ea2

PDB Entry: 6b1e, 1.77 Å

PDB Description: the structure of dpp4 in complex with vildagliptin

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d6b1ea2:

Sequence; same for both SEQRES and ATOM records:

>d6b1ea2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d6b1ea2:

• d6b1ea2 first appeared in SCOPe 2.06
  
• d6b1ea2 appears in the current release, SCOPe 2.08