Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein automated matches [190420] (9 species) not a true protein |
Species Momordica balsamina [TaxId:3672] [189375] (73 PDB entries) |
Domain d5y48a_: 5y48 A: [339397] automated match to d3my6a_ complexed with nag, ura |
PDB Entry: 5y48 (more details), 1.7 Å
SCOPe Domain Sequences for d5y48a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y48a_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]} dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll lntkni
Timeline for d5y48a_: