Lineage for d5tw5a2 (5tw5 A:186-279)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (670 PDB entries)
  8. 2357983Domain d5tw5a2: 5tw5 A:186-279 [339303]
    Other proteins in same PDB: d5tw5a1, d5tw5b_
    automated match to d1zt4c1
    complexed with 7lm, nag, plm

Details for d5tw5a2

PDB Entry: 5tw5 (more details), 1.85 Å

PDB Description: structure of mouse cd1d with bound glycosphingolipid jj112
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d5tw5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tw5a2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d5tw5a2:

Click to download the PDB-style file with coordinates for d5tw5a2.
(The format of our PDB-style files is described here.)

Timeline for d5tw5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tw5a1
View in 3D
Domains from other chains:
(mouse over for more information)
d5tw5b_