Lineage for d1bxgb2 (1bxg B:401-548)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125088Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 125089Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 125090Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
  6. 125159Protein Phenylalanine dehydrogenase [53233] (1 species)
  7. 125160Species Rhodococcus sp., M4 [TaxId:1831] [53234] (4 PDB entries)
  8. 125168Domain d1bxgb2: 1bxg B:401-548 [33925]
    Other proteins in same PDB: d1bxga1, d1bxgb1

Details for d1bxgb2

PDB Entry: 1bxg (more details), 2.3 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and beta-phenylpropionate

SCOP Domain Sequences for d1bxgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxgb2 c.58.1.1 (B:401-548) Phenylalanine dehydrogenase {Rhodococcus sp., M4}
sidsalnwdgemtvtrfdrmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
tnsadmdtlndttefvfgrslerggags

SCOP Domain Coordinates for d1bxgb2:

Click to download the PDB-style file with coordinates for d1bxgb2.
(The format of our PDB-style files is described here.)

Timeline for d1bxgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bxgb1