Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein Alanine-glyoxylate aminotransferase [89757] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [89758] (11 PDB entries) |
Domain d5lucn_: 5luc N: [339112] automated match to d4kyoc_ complexed with btb, plp |
PDB Entry: 5luc (more details), 1.8 Å
SCOPe Domain Sequences for d5lucn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lucn_ c.67.1.3 (N:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} hkllvtppkallkplsipnqlllgpgpsnlpprimaagglqmigsmskdmyqimdeikeg iqyvfqtrnpltlvisgsghcaleaalvnvlepgdsflvgangiwgqravdigerigarv hpmtkdpgghytlqeveeglaqhkpvllflthgesstgvlqpldgfgelchrykclllvn svaslggtplymdrqgidilysgsqkalnappgtslisfsdkakkkmysrktkpfsfyld ikwlanfwgcddqprmyhhtipvislyslreslaliaeqglenswrqhreaaaylhgrlq alglqlfvkdpalrlptvttvavpagydwrdivsyvidhfdieimgglgpstgkvlrigl lgcnatrenvdrvtealraalqhcpkk
Timeline for d5lucn_: