Lineage for d2tmge2 (2tmg E:4-178)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489479Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 489480Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 489481Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 489482Protein Glutamate dehydrogenase [53225] (7 species)
  7. 489564Species Thermotoga maritima [TaxId:243274] [53229] (3 PDB entries)
  8. 489581Domain d2tmge2: 2tmg E:4-178 [33890]
    Other proteins in same PDB: d2tmga1, d2tmgb1, d2tmgc1, d2tmgd1, d2tmge1, d2tmgf1

Details for d2tmge2

PDB Entry: 2tmg (more details), 2.9 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e

SCOP Domain Sequences for d2tmge2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmge2 c.58.1.1 (E:4-178) Glutamate dehydrogenase {Thermotoga maritima}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvel

SCOP Domain Coordinates for d2tmge2:

Click to download the PDB-style file with coordinates for d2tmge2.
(The format of our PDB-style files is described here.)

Timeline for d2tmge2: