Lineage for d1bvub2 (1bvu B:3-180)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) 
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins) 
Protein Glutamate dehydrogenase [53225] (6 species) 
Species Archaeon Thermococcus litoralis [TaxId:2265] [53228] (1 PDB entry) 
Domain d1bvub2: 1bvu B:3-180 [33875]
Other proteins in same PDB: d1bvua1, d1bvub1, d1bvuc1, d1bvud1, d1bvue1, d1bvuf1
Details for d1bvub2
PDB Entry: 1bvu (more details), 2.5 Å
PDB Description: glutamate dehydrogenase from thermococcus litoralis
SCOP Domain Sequences for d1bvub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvub2 c.58.1.1 (B:3-180) Glutamate dehydrogenase {Archaeon Thermococcus litoralis}
qdpfeiavkqleraaqymdiseealeflkrpqrivevsipvemddgsvkvftgfrvqynw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggvicnpkemsdrekerl
argyvraiydvispytdipapdvytnpqimawmmdeyetisrrkdpsfgvitgkppsv
SCOP Domain Coordinates for d1bvub2:
Click to download the PDB-style file with coordinates for d1bvub2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bvub2:
View in 3D
