SCOPe 2.07: Domain d5o4ea1: 5o4e A:236-339

Lineage for d5o4ea1 (5o4e A:236-339)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d5o4ea1: 5o4e A:236-339 [338650]
Other proteins in same PDB: d5o4eb2, d5o4ed2, d5o4ee_, d5o4ef_
automated match to d1hzhk3
complexed with bma, cac, fuc, man, mpd, mrd, nag, trs

Details for d5o4ea1

PDB Entry: 5o4e (more details), 2.15 Å

PDB Description: crystal structure of vegf in complex with heterodimeric fcab janusct6

PDB Compounds: (A:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d5o4ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o4ea1 b.1.1.2 (A:236-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d5o4ea1:

Click to download the PDB-style file with coordinates for d5o4ea1.
(The format of our PDB-style files is described here.)

Timeline for d5o4ea1: