SCOPe 2.07: Domain d5h2fl_: 5h2f L:

Lineage for d5h2fl_ (5h2f L:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein automated matches [191003] (2 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [338576] (1 PDB entry)

8. Domain d5h2fl_: 5h2f L: [338577]
   Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fo_, d5h2ft_, d5h2fu_, d5h2fv_, d5h2fx_, d5h2fz_
   automated match to d2axtl1
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fl_

PDB Entry: 5h2f, 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii

PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5h2fl_:

Sequence; same for both SEQRES and ATOM records:

>d5h2fl_ f.23.31.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
pnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d5h2fl_:

• d5h2fl_ first appeared in SCOPe 2.06
  
• d5h2fl_ appears in the current release, SCOPe 2.08