SCOPe 2.07: Domain d5urab1: 5ura B:1-132

Lineage for d5urab1 (5ura B:1-132)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)

8. Domain d5urab1: 5ura B:1-132 [338271]
   Other proteins in same PDB: d5uraa2, d5urab2, d5urac2, d5urad2
   automated match to d5bvqa_
   complexed with 8ks, so4

Details for d5urab1

PDB Entry: 5ura, 1.85 Å

PDB Description: enantiomer-specific binding of the potent antinociceptive agent sbfi- 26 to anandamide transporters fabp7

PDB Compounds: (B:) fatty acid-binding protein, brain

SCOPe Domain Sequences for d5urab1:

Sequence; same for both SEQRES and ATOM records:

>d5urab1 b.60.1.2 (B:1-132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mveafcatwkltnsqnfdeymkalgvgfatrqvgnvtkptviisqegdkvvirtlstfkn
teisfqlgeefdettaddrncksvvsldgdklvhiqkwdgketnfvreikdgkmvmtltf
gdvvavrhyeka

Timeline for d5urab1:

• d5urab1 first appeared in SCOPe 2.06
  
• d5urab1 appears in the current release, SCOPe 2.08