SCOPe 2.07: Domain d1ayea1: 1aye A:1-309

Lineage for d1ayea1 (1aye A:1-309)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53192] (6 PDB entries)

8. Domain d1ayea1: 1aye A:1-309 [33824]
   Other proteins in same PDB: d1ayea2
   procarboxypeptidase A2
   complexed with zn

Details for d1ayea1

PDB Entry: 1aye, 1.8 Å

PDB Description: human procarboxypeptidase a2

PDB Compounds: (A:) procarboxypeptidase a2

SCOPe Domain Sequences for d1ayea1:

Sequence; same for both SEQRES and ATOM records:

>d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]}
ersgnfnfgayhtleeisqemdnlvaehpglvskvnigssfenrpmnvlkfstggdkpai
wldagiharewvtqatalwtankivsdygkdpsitsildaldifllpvtnpdgyvfsqtk
nrmwrktrskvsgslcvgvdpnrnwdagfggpgassnpcsdsyhgpsansevevksivdf
ikshgkvkafiilhsysqllmfpygykctklddfdelsevaqkaaqslrslhgtkykvgp
icsviyqasggsidwsydygikysfafelrdtgrygfllparqilptaeetwlglkaime
hvrdhpy

Timeline for d1ayea1:

• d1ayea1 first appeared (with stable ids) in SCOP 1.55, called d1aye_1
  
• d1ayea1 appears in SCOPe 2.06
  
• d1ayea1 appears in the current release, SCOPe 2.08