Lineage for d5o4cl_ (5o4c L:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632597Protein L (light) subunit [81477] (3 species)
  7. 2632672Species Rhodopseudomonas viridis [TaxId:1079] [81474] (21 PDB entries)
  8. 2632686Domain d5o4cl_: 5o4c L: [337912]
    Other proteins in same PDB: d5o4cc_, d5o4ch1, d5o4ch2, d5o4cm_
    automated match to d6prcl_
    complexed with bcb, bpb, dga, fe2, hec, hto, lda, mq7, ns5, so4

Details for d5o4cl_

PDB Entry: 5o4c (more details), 2.8 Å

PDB Description: from macrocrystals to microcrystals: a strategy for membrane protein serial crystallography
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d5o4cl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o4cl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

SCOPe Domain Coordinates for d5o4cl_:

Click to download the PDB-style file with coordinates for d5o4cl_.
(The format of our PDB-style files is described here.)

Timeline for d5o4cl_: