Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein L (light) subunit [81477] (3 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [81474] (21 PDB entries) |
Domain d5o4cl_: 5o4c L: [337912] Other proteins in same PDB: d5o4cc_, d5o4ch1, d5o4ch2, d5o4cm_ automated match to d6prcl_ complexed with bcb, bpb, dga, fe2, hec, hto, lda, mq7, ns5, so4 |
PDB Entry: 5o4c (more details), 2.8 Å
SCOPe Domain Sequences for d5o4cl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o4cl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]} allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni fltgafgtiasgpfwtrgwpewwgwwldipfws
Timeline for d5o4cl_:
View in 3D Domains from other chains: (mouse over for more information) d5o4cc_, d5o4ch1, d5o4ch2, d5o4cm_ |