Lineage for d5w97c_ (5w97 C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027151Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 3027152Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 3027153Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 3027166Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 3027167Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)
  8. 3027265Domain d5w97c_: 5w97 C: [337788]
    Other proteins in same PDB: d5w97a_, d5w97b1, d5w97b2, d5w97d_, d5w97e_, d5w97f_, d5w97g_, d5w97h_, d5w97i_, d5w97j_, d5w97k_, d5w97l_, d5w97m_
    automated match to d1v54c_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5w97c_

PDB Entry: 5w97 (more details), 2.3 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by serial femtosecond x-ray crystallography at room temperature
PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d5w97c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w97c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d5w97c_:

Click to download the PDB-style file with coordinates for d5w97c_.
(The format of our PDB-style files is described here.)

Timeline for d5w97c_: