SCOPe 2.08: Domain d5x1fh_: 5x1f H:

Lineage for d5x1fh_ (5x1f H:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)

6. Protein Cytochrome c oxidase subunit h [47696] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47697] (33 PDB entries)

8. Domain d5x1fh_: 5x1f H: [337677]
   Other proteins in same PDB: d5x1fa_, d5x1fb1, d5x1fb2, d5x1fc_, d5x1fd_, d5x1fe_, d5x1ff_, d5x1fg_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fo1, d5x1fo2, d5x1fp_, d5x1fq_, d5x1fr_, d5x1fs_, d5x1ft_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_
   automated match to d1v54h_
   complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1fh_

PDB Entry: 5x1f, 2.2 Å

PDB Description: co bound cytochrome c oxidase without pump laser irradiation at 278k

PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5x1fh_:

Sequence; same for both SEQRES and ATOM records:

>d5x1fh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

Timeline for d5x1fh_:

• d5x1fh_ first appeared in SCOPe 2.06
  
• d5x1fh_ appears in SCOPe 2.07