![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) ![]() automatically mapped to Pfam PF02238 |
![]() | Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81416] (55 PDB entries) |
![]() | Domain d5wauj_: 5wau J: [337640] Other proteins in same PDB: d5waua_, d5waub1, d5waub2, d5wauc_, d5waud_, d5waue_, d5wauf_, d5waug_, d5wauh_, d5waui_, d5wauk_, d5waul_, d5waum_ automated match to d1v54j_ complexed with cdl, chd, cmo, cu, cua, dmu, fme, hea, mg, na, pek, pgv, psc, sac, tgl, zn |
PDB Entry: 5wau (more details), 1.95 Å
SCOPe Domain Sequences for d5wauj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wauj_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]} fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
Timeline for d5wauj_: