Lineage for d5w97h_ (5w97 H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714739Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714740Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2714741Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2714742Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2714743Species Cow (Bos taurus) [TaxId:9913] [47697] (33 PDB entries)
  8. 2714793Domain d5w97h_: 5w97 H: [337628]
    Other proteins in same PDB: d5w97a_, d5w97b1, d5w97b2, d5w97c_, d5w97d_, d5w97e_, d5w97f_, d5w97g_, d5w97i_, d5w97j_, d5w97k_, d5w97l_, d5w97m_
    automated match to d1v54h_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5w97h_

PDB Entry: 5w97 (more details), 2.3 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by serial femtosecond x-ray crystallography at room temperature
PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5w97h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w97h_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d5w97h_:

Click to download the PDB-style file with coordinates for d5w97h_.
(The format of our PDB-style files is described here.)

Timeline for d5w97h_: