Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.1: HybD-like [53163] (2 families) the HybD fold coincides with the consensus core structure |
Family c.56.1.1: Hydrogenase maturating endopeptidase HybD [53164] (1 protein) |
Protein Hydrogenase maturating endopeptidase HybD [53165] (1 species) |
Species Escherichia coli [TaxId:562] [53166] (1 PDB entry) |
Domain d1cfzf_: 1cfz F: [33759] complexed with cd |
PDB Entry: 1cfz (more details), 2.2 Å
SCOP Domain Sequences for d1cfzf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cfzf_ c.56.1.1 (F:) Hydrogenase maturating endopeptidase HybD {Escherichia coli} mrilvlgvgnilltdeaigvrivealeqryilpdyveildggtagmellgdmanrdhlii adaivskknapgtmmilrdeevpalftnkisphqlgladvlsalrftgefpkkltlvgvi peslephigltptveamiepaleqvlaalresgveaiprsds
Timeline for d1cfzf_: