SCOP 1.67: Domain d1cfze_: 1cfz E:

Lineage for d1cfze_ (1cfz E:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.1: HybD-like [53163] (2 families)
   the HybD fold coincides with the consensus core structure

5. Family c.56.1.1: Hydrogenase maturating endopeptidase HybD [53164] (1 protein)

6. Protein Hydrogenase maturating endopeptidase HybD [53165] (1 species)

7. Species Escherichia coli [TaxId:562] [53166] (1 PDB entry)

8. Domain d1cfze_: 1cfz E: [33758]

Details for d1cfze_

PDB Entry: 1cfz, 2.2 Å

PDB Description: hydrogenase maturating endopeptidase hybd from e. coli

SCOP Domain Sequences for d1cfze_:

Sequence; same for both SEQRES and ATOM records:

>d1cfze_ c.56.1.1 (E:) Hydrogenase maturating endopeptidase HybD {Escherichia coli}
mrilvlgvgnilltdeaigvrivealeqryilpdyveildggtagmellgdmanrdhlii
adaivskknapgtmmilrdeevpalftnkisphqlgladvlsalrftgefpkkltlvgvi
peslephigltptveamiepaleqvlaalresgveaiprsds

Timeline for d1cfze_:

• d1cfze_ first appeared (with stable ids) in SCOP 1.55
  
• d1cfze_ appears in SCOP 1.65
  
• d1cfze_ appears in SCOP 1.69
  
• d1cfze_ appears in the current release, SCOPe 2.08