SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mx2o_ (5mx2 O:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2224301Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2224302Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2224344Family f.4.1.4: PsbO-like [161115] (2 protein domains)
    Pfam PF01716; MSP
  6. 2224355Protein automated matches [191004] (2 species)
    not a true protein
  7. 2224356Species Thermosynechococcus elongatus [TaxId:197221] [260553] (5 PDB entries)
  8. 2294167Domain d5mx2o_: 5mx2 O: [337468]
    Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2d_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2u_, d5mx2v_
    automated match to d4il6o_
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2o_

PDB Entry: 5mx2 (more details), 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d5mx2o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx2o_ f.4.1.4 (O:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
ep

SCOPe Domain Coordinates for d5mx2o_:

Click to download the PDB-style file with coordinates for d5mx2o_.
(The format of our PDB-style files is described here.)

Timeline for d5mx2o_:

  • d5mx2o_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03