Lineage for d5xqyg_ (5xqy G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2369203Domain d5xqyg_: 5xqy G: [337421]
    automated match to d4v1db_
    mutant

Details for d5xqyg_

PDB Entry: 5xqy (more details), 2.9 Å

PDB Description: structure of monomeric mutant of rei immunoglobulin light chain variable domain crystallized at ph 8
PDB Compounds: (G:) Immunoglobulin kappa variable 1D-33

SCOPe Domain Sequences for d5xqyg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xqyg_ b.1.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
srfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr

SCOPe Domain Coordinates for d5xqyg_:

Click to download the PDB-style file with coordinates for d5xqyg_.
(The format of our PDB-style files is described here.)

Timeline for d5xqyg_: