SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xvkb_ (5xvk B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (63 species)
    not a true protein
  7. 2130813Species Mouse (Mus musculus) [TaxId:10090] [187843] (14 PDB entries)
  8. 2294098Domain d5xvkb_: 5xvk B: [337399]
    automated match to d2i62b_
    complexed with 8gc, gol, sah

Details for d5xvkb_

PDB Entry: 5xvk (more details), 1.88 Å

PDB Description: crystal structure of mouse nicotinamide n-methyltransferase (nnmt) bound with end product, 1-methyl nicotinamide (mna)
PDB Compounds: (B:) Nicotinamide N-methyltransferase

SCOPe Domain Sequences for d5xvkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xvkb_ c.66.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gftskdtylshfnprdylekyysfgsrhcaeneilrhllknlfkifclgavkgellidig
sgptiyqllsacesfteiivsdytdqnlwelqkwlkkepgafdwspvvtyvcdlegnrmk
gpekeeklrraikqvlkcdvtqsqplggvslppadcllstlcldaacpdlpayrtalrnl
gsllkpggflvmvdalkssyymigeqkfsslplgwetvrdaveeagytieqfevisqnys
sttsnneglfslvgrkpg

SCOPe Domain Coordinates for d5xvkb_:

Click to download the PDB-style file with coordinates for d5xvkb_.
(The format of our PDB-style files is described here.)

Timeline for d5xvkb_:

  • d5xvkb_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03