Lineage for d5wb6a_ (5wb6 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2407751Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2407752Protein automated matches [190438] (33 species)
    not a true protein
  7. 2407799Species Human (Homo sapiens) [TaxId:9606] [187421] (92 PDB entries)
  8. 2407900Domain d5wb6a_: 5wb6 A: [337359]
    automated match to d1p57b_
    complexed with 9zm, edo, so4

Details for d5wb6a_

PDB Entry: 5wb6 (more details), 2.35 Å

PDB Description: factor xia in complex with the inhibitor methyl [(11s)-11-({(2e)-3-[5- chloro-2-(1h-tetrazol-1-yl)phenyl]prop-2-enoyl}amino)-6-fluoro-2-oxo- 1,3,4,10,11,13-hexahydro-2h-5,9:15,12-di(azeno)-1,13- benzodiazacycloheptadecin-18-yl]carbamate
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d5wb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wb6a_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d5wb6a_:

Click to download the PDB-style file with coordinates for d5wb6a_.
(The format of our PDB-style files is described here.)

Timeline for d5wb6a_: