SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5thpk_ (5thp K:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2208776Family d.169.1.1: C-type lectin domain [56437] (29 protein domains)
    Pfam PF00059
  6. 2209209Protein automated matches [190329] (9 species)
    not a true protein
  7. 2209253Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (3 PDB entries)
  8. 2294011Domain d5thpk_: 5thp K: [337312]
    Other proteins in same PDB: d5thpc_, d5thpf_, d5thpi_, d5thpl_, d5thpo_, d5thpr_
    automated match to d1v7pb_
    complexed with cl, gol, mg, na, so4

Details for d5thpk_

PDB Entry: 5thp (more details), 3.01 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain
PDB Compounds: (K:) Snaclec rhodocetin subunit delta

SCOPe Domain Sequences for d5thpk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thpk_ d.169.1.1 (K:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
vfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlkytsmwlglnnpwkec
kwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvckf

SCOPe Domain Coordinates for d5thpk_:

Click to download the PDB-style file with coordinates for d5thpk_.
(The format of our PDB-style files is described here.)

Timeline for d5thpk_:

  • d5thpk_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03