Lineage for d5xl5d_ (5xl5 D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645446Species Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [346451] (9 PDB entries)
  8. 2645452Domain d5xl5d_: 5xl5 D: [337306]
    Other proteins in same PDB: d5xl5a_, d5xl5b_
    automated match to d4d00d_
    complexed with nag; mutant

Details for d5xl5d_

PDB Entry: 5xl5 (more details), 2.2 Å

PDB Description: the structure of hemagglutinin q226l mutant from an avian-origin h4n6 influenza virus
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d5xl5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xl5d_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
dkyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
rvrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq

SCOPe Domain Coordinates for d5xl5d_:

Click to download the PDB-style file with coordinates for d5xl5d_.
(The format of our PDB-style files is described here.)

Timeline for d5xl5d_: