Lineage for d5thpp_ (5thp P:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607740Protein automated matches [190329] (10 species)
    not a true protein
  7. 2607803Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (10 PDB entries)
  8. 2607859Domain d5thpp_: 5thp P: [337261]
    Other proteins in same PDB: d5thpc_, d5thpf_, d5thpi_, d5thpl_, d5thpo_, d5thpr_
    automated match to d1v4la_
    complexed with cl, gol, mg, na, so4

Details for d5thpp_

PDB Entry: 5thp (more details), 3.01 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain
PDB Compounds: (P:) Snaclec rhodocetin subunit gamma

SCOPe Domain Sequences for d5thpp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thpp_ d.169.1.1 (P:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
fnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnni
krpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdc
qaknpfvckfps

SCOPe Domain Coordinates for d5thpp_:

Click to download the PDB-style file with coordinates for d5thpp_.
(The format of our PDB-style files is described here.)

Timeline for d5thpp_: